TRA monoclonal antibody (M03), clone 4H8

• standard

• Product description:
• The mouse monoclonal antibody targets part of the recombinant TRA.

• Immune | epidemic agent
• TRA (CAA25651.1133 aa~232 aa) with GST label Recombinant protein 。 Only the MW of GST label is 26 KDa.

• Sequence:
• NIQNPDPAVYQLRDSKSSDKSVCLFTDFDSQTNVSQSKDSDVYITDKTVLDMRSMDFKSNSAVAWSNKSDFACANAFNNSIIPEDTFFPSPESSCDVKLV

• host:
• mouse

• Reactivity:
• Human

• Same type:
• IgG2aκ

• Quality control test:
• Antibodies that are reactive to the recombinant protein.
  
  
  Western Blot test (36.74 KDa) for immune | epidemic agent.

• Storage buffer:
• PH 7.4 in 1x PBS

• Storage instructions:
• Store at - 20 ° C or lower. Divide the sample equally to avoid repeated freezing and thawing.

Toxin Technologies Agency Related Literature 2020

First of all, the correct solution resuspension lyophilization powder should be selected, generally as recommended in the instruction manual.
There are many solutions that can be used for the dissolution of cytokine lyophilized powder, some can be directly dissolved with sterile water, and some need buffers of different components. For example, recombinant human IL-4 can be dissolved with water, but recombinant human IL-2 needs to be dissolved with 100 mM acetic acid,
Recombinant IL-13 requires 20mM HCI to dissolve, recombinant human TGFB1 requires 10mM citric acid to dissolve, and recombinant human FGF-10 requires 5mM sodium phosphate to dissolve.
For the recombinant cytokine freeze-dried powder, even if it is the same molecule protein, the dissolution method may be different between different batches. Therefore, each of our outgoing products will have a copy of COA information along with the product packaging
The specific requirements for product dissolution shall be clearly written. Of course, you can also get detailed information about this product by contacting us before purchasing.

Toxin Technologies Agency Related Literature 2020
Maybe when you see here, you have a question. Why do you need so many methods for a simple dissolution?
In fact, this is determined by the nature of the protein. We know that there are many factors that affect the solubility of protein, and the more important ones are the pH value and ionic strength of the solution. Every recombinant protein of cytokines will be strictly finished before being delivered out of the warehouse!
The whole QC inspection will test the Zui good solution of freeze-dried powder, and mark the solution that can completely dissolve the product of this factor.